LOCUS       S75835S2      152 bp    DNA             INV       26-JUL-1995
DEFINITION  Endo16=endoderm-specific marker gene {5' regulatory region}
            [Strongylocentrotus purpuratus=sea urchins, embryo, Genomic, 152
            nt, segment 2 of 2].
ACCESSION   S75836
NID         g913824
KEYWORDS    .
            2 of 2
SOURCE      purple urchin embryo.
  ORGANISM  Strongylocentrotus purpuratus
            Eukaryotae; mitochondrial eukaryotes; Metazoa; Echinodermata;
            Echinozoa; Echinoidea; Euechinoidea; Echinacea; Echinoida;
            Strongylocentrotidae; Strongylocentrotus.
REFERENCE   1  (bases 1 to 152)
  AUTHORS   Yuh,C.H., Ransick,A., Martinez,P., Britten,R.J. and Davidson,E.H.
  TITLE     Complexity and organization of DNA-protein interactions in the
            5'-regulatory region of an endoderm-specific marker gene in the sea
            urchin embryo
  JOURNAL   Mech. Dev. 47 (2), 165-186 (1994)
  MEDLINE   95110745
  REMARK    GenBank staff at the National Library of Medicine created this
            entry [NCBI gibbsq 161743] from the original journal article.
            This sequence comes from Fig. 1C.
FEATURES             Location/Qualifiers
     source          1..152
                     /organism="Strongylocentrotus purpuratus"
                     /db_xref="taxon:7668"
     mRNA            join(S75835:2281..2391,1..152)
     gene            order(S75835:2307..2391,1..152)
                     /partial
                     /note="endoderm-specific marker gene; exclusively
                     expressed in cells of the vegetal plate and archenteron in
                     the embryos"
                     /gene="Endo16"
     CDS             join(S75835:2307..2391,1..152)
                     /partial
                     /gene="Endo16"
                     /note="exon 2 numbering approximate base on numbering Fig.
                     1C"
                     /codon_start=1
                     /translation="MMRLNILLFAVLAVARSMPTGKKYNNFTKLQCDIDEAHTNVGTP
                     RVVDDDSNSLMIFQL"
BASE COUNT       41 a     40 c     36 g     35 t
ORIGIN
        1 agttgcaatg tgacatcgac gaggcccata cgaatgttgg aacaccacga gtagtcgacg
       61 atgactctaa ctcactcatg atcttccaac tttgagcttt cactcgacga ggtcgacgag
      121 ggcttcctac ccgagatcga atatgcagtc ag
//