homo

LOCUS       NM_000034    1464 bp    mRNA            PRI       01-APR-1999
     DEFINITION Homo sapiens aldolase A, fructose-bisphosphate (ALDOA) mRNA.
     ACCESSION   NM_000034
     VERSION     NM_000034.1 GI:4557304
     KEYWORDS    .
     SOURCE      human.
       ORGANISM Homo sapiens
                 Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Mammalia;
                 Eutheria; Primates; Catarrhini; Hominidae; Homo.
     REFERENCE   1 (bases 1 to 1464)
       AUTHORS   Sakakibara,M., Mukai,T. and Hori,K.
       TITLE     Nucleotide sequence of a cDNA clone for human aldolase: a messenger
                 RNA in the liver
       JOURNAL   Biochem. Biophys. Res. Commun. 131 (1), 413-420 (1985)
       MEDLINE   85306986
     REFERENCE   2 (sites)
       AUTHORS   Maire,P., Gautron,S., Hakim,V., Gregori,C., Mennecier,F. and
                 Kahn,A.
       TITLE     Characterization of three optional promoters in the 5' region of
                 the human aldolase A gene
       JOURNAL   J. Mol. Biol. 197 (3), 425-438 (1987)
       MEDLINE   88155643
     REFERENCE   3 (bases 1 to 1464)
       AUTHORS   Izzo,P., Costanzo,P., Lupo,A., Rippa,E., Paolella,G. and
                 Salvatore,F.
       TITLE     Human aldolase A gene. Structural organization and tissue-specific
                 expression by multiple promoters and alternate mRNA processing
       JOURNAL   Eur. J. Biochem. 174 (4), 569-578 (1988)
       MEDLINE   88271327
     COMMENT     REFSEQ: This reference sequence was derived from M11560.
                 Summary: The ALDOA gene product, Aldolase A (fructose-bisphosphate
                 aldolase; EC 4.1.2.13 ) is a glycolytic enzyme that catalyzes the
                 reversible conversion of fructose-1,6-bisphosphate to
                 glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three
                 aldolase isozymes (A, B, and C), encoded by three different genes,
                 are differentially expressed during development. Aldolase A is
                 found in the developing embryo and is produced in even greater
                 amounts in adult muscle. Aldolase A expression is repressed in
                 adult liver, kidney and intestine, and aldolase B is produced. In
                 brain and other nervous tissue, aldolase A and C expression is
                 about equal. Aldolase A deficiency has been associated with
                 myopathy and hemolytic anemia.
     FEATURES             Location/Qualifiers
          source          1..1464
                          /organism="Homo sapiens"
                          /db_xref="taxon:9606"
                          /chromosome="16"
                          /map="16q22.2"
                          /tissue_type="liver"
          gene            1..1464
                          /gene="ALDOA"
                          /db_xref="LocusID:226"
                          /db_xref="MIM:103850"
          CDS             168..1262
                          /gene="ALDOA"
                          /EC_number="4.1.2.13"
                          /note="fructose-bisphosphate aldolase"
                          /codon_start=1
                          /product="aldolase A"
                          /protein_id="NP_000025.1"
                          /db_xref="GI:4557305"
                          /translation="MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRL
                          QSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKG
                          GVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPS
                          ALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALS
                          DHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQS
                          EEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALA
                          NSLACQGKYTPSGQAGAAASESLFVSNHAY"
     BASE COUNT      310 a    452 c    409 g    293 t
     ORIGIN
             1 agtaccgggt acgcaggggt gcctcaacca cactccgtcc acggactctc cgttatttta
            61 ggaggtccct ggccaaagat ttatttctct tgacaaccaa gggcctccgt ctggatttcc
           121 aaggaagaat ttcctctgaa gcaccggaac ttgctactac cagcaccatg ccctaccaat
           181 atccagcact gaccccggag cagaagaagg agctgtctga catcgctcac cgcatcgtgg
           241 cacctggcaa gggcatcctg gctgcagatg agtccactgg gagcattgcc aagcggctgc
           301 agtccattgg caccgagaac accgaggaga accggcgctt ctaccgccag ctgctgctga
           361 cagctgacga ccgcgtgaac ccctgcattg ggggtgtcat cctcttccat gagacactct
           421 accagaaggc ggatgatggg cgtcccttcc cccaagttat caaatccaag ggcggtgttg
           481 tgggcatcaa ggtagacaag ggcgtggtcc ccctggcagg gacaaatggc gagactacca
           541 cccaagggtt ggatgggctg tctgagcgct gtgcccagta caagaaggac ggagctgact
           601 tcgccaagtg gcgttgtgtg ctgaagattg gggaacacac cccctcagcc ctcgccatca
           661 tggaaaatgc caatgttctg gcccgttatg ccagtatctg ccagcagaat ggcattgtgc
           721 ccatcgtgga gcctgagatc ctccctgatg gggaccatga cttgaagcgc tgccagtatg
           781 tgaccgagaa ggtgctggct gctgtctaca aggctctgag tgaccaccac atctacctgg
           841 aaggcacctt gctgaagccc aacatggtca ccccaggcca tgcttgcact cagaagtttt
           901 ctcatgagga gattgccatg gcgaccgtca cagcgctgcg ccgcacagtg ccccccgctg
           961 tcactgggat caccttcctg tctggaggcc agagtgagga ggaggcgtcc atcaacctca
          1021 atgccattaa caagtgcccc ctgctgaagc cctgggccct gaccttctcc tacggccgag
          1081 ccctgcaggc ctctgccctg aaggcctggg gcgggaagaa ggagaacctg aaggctgcgc
          1141 aggaggagta tgtcaagcga gccctggcca acagccttgc ctgtcaagga aagtacactc
          1201 cgagcggtca ggctggggct gctgccagcg agtccctctt cgtctctaac cacgcctatt
          1261 aagcggaggt gttcccaggc tgcccccaac aactccaggc cctgccccct cccactcttg
          1321 aagaggaggc cgcctcctcg gggctccagg ctggcttgcc cgcgctcttt cttccctcgt
          1381 gacagtggtg tgtggtgtcg tctgtgaatg ctaagtccat caccctttcc ggcacactgc
          1441 caaataaaca gctatttaag gggg
     //