LOCUS M10217 688 bp DNA VRT 16-MAR-2000 DEFINITION CDS from: Xenopus laevis mitochondrial DNA, complete genome. ACCESSION M10217 VERSION M10217.1 KEYWORDS . SOURCE African clawed frog. ORGANISM Mitochondrion Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae; Xenopodinae; Xenopus. REFERENCE 1 (bases 1 to 2231; 6969 to 7429; 17388 to 17553) AUTHORS Wong,J.F., Ma,D.P., Wilson,R.K. and Roe,B.A. TITLE DNA sequence of the Xenopus laevis mitochondrial heavy and light strand replication origins and flanking tRNA genes JOURNAL Nucleic Acids Res. 11 (14), 4977-4995 (1983) MEDLINE 83272945 REFERENCE 2 (bases 9109 to 9796) AUTHORS Roe,B.A., Ma,D.P., Wilson,R.K. and Wong,J.F. TITLE The complete nucleotide sequence of the Xenopus laevis mitochondrial genome JOURNAL J. Biol. Chem. 260 (17), 9759-9774 (1985) MEDLINE 85261388 COMMENT Reprint and sequence in computer readable form for [2] (with revisions for [1]) kindly provided by B.A.Roe, 09-DEC-1985. The L-strand is presented below. Repeats are found in the D-loop at positions 29-73 and 90-134. FEATURES Location/Qualifiers CDS 1..688 /note="TAA stop codon is completed by the addition of 3' A residues to the mRNA" /codon_start=1 /transl_except=(pos:688,aa:TERM) /transl_table=2 /product="cytochrome c oxidase subunit II" /protein_id="AAA66461.1" /db_xref="PID:g807686" /db_xref="GI:807686" /translation="MAHPSQLGFQDAASPIMEELLHFHDHTLMAVFLISTLVLYIITI MMTTKLTNTNLMDAQEIEMVWTIMPAISLIMIALPSLRILYLMDEVNDPHLTIKAIGH QWYWSYEYTNYEDLSFDSYMIPTNDLTPGQFRLLEVDNRMVVPMESPTRLLVTAEDVL HSWAVPSLGVKTDAIPGRLHQTSFIATRPGVFYGQCSEICGANHSFMPIVVEAVPLTD FENWSSSMLEA" BASE COUNT 221 a 168 c 101 g 198 t ORIGIN 1 atggcacacc catcacaatt aggttttcaa gacgcagcct ctccaattat agaagaatta 61 cttcacttcc acgaccatac cctcatagcc gtttttctta ttagtacgct agttctttac 121 attattacta ttataataac tactaaacta actaatacaa acctaatgga cgcacaagag 181 atcgaaatag tgtgaactat tataccagct attagcctca tcataattgc ccttccatcc 241 cttcgtatcc tatatttaat agatgaagtt aatgatccac acttaacaat taaagcaatc 301 ggccaccaat gatactgaag ctacgaatat actaactatg aggatctctc atttgactct 361 tatataattc caactaatga ccttacccct ggacaattcc ggctgctaga agttgataat 421 cgaatagtag tcccaataga atctccaacc cgacttttag ttacagccga agacgtcctc 481 cactcgtgag ctgtaccctc cttgggtgtc aaaacagatg caatcccagg acgacttcat 541 caaacatcat ttattgctac tcgtccggga gtattttacg gacaatgttc agaaatttgc 601 ggagcaaacc acagctttat accaattgta gttgaagcag taccgctaac cgactttgaa 661 aactgatctt catcaatact agaagcat 721 781 841 901 961 1021 1081 1141 1201 1261 1321 1381 1441 1501 1561 1621 1681 1741 1801 1861 1921 1981 2041 2101 2161 2221 2281 2341 2401 2461 2521 2581 2641 2701 2761 2821 2881 2941 3001 3061 3121 3181 3241 3301 3361 3421 3481 3541 3601 3661 3721 3781 3841 3901 3961 4021 4081 4141 4201 4261 4321 4381 4441 4501 4561 4621 4681 4741 4801 4861 4921 4981 5041 5101 5161 5221 5281 5341 5401 5461 5521 5581 5641 5701 5761 5821 5881 5941 6001 6061 6121 6181 6241 6301 6361 6421 6481 6541 6601 6661 6721 6781 6841 6901 6961 7021 7081 7141 7201 7261 7321 7381 7441 7501 7561 7621 7681 7741 7801 7861 7921 7981 8041 8101 8161 8221 8281 8341 8401 8461 8521 8581 8641 8701 8761 8821 8881 8941 9001 9061 9121 9181 9241 9301 9361 9421 9481 9541 9601 9661 9721 9781 //