LOCUS       PFAHEL2A      297 bp    mRNA            INV       10-NOV-1994
DEFINITION  Plasmodium falciparum DNA helicase (hel2) mRNA, partial cds.
ACCESSION   L29343
NID         g567851
KEYWORDS    DNA helicase.
SOURCE      Plasmodium falciparum cDNA to mRNA.
  ORGANISM  Plasmodium falciparum
            Eukaryotae; mitochondrial eukaryotes; Alveolata; Apicomplexa;
            Haemosporida; Plasmodium.
REFERENCE   1  (sites)
  AUTHORS   Emery,H.S., Schild,D., Kellogg,D.E. and Mortimer,R.K.
  TITLE     Sequence of RAD54, a Saccharomyces cerevisiae gene involved in
            recombination and repair
  JOURNAL   Gene 104 (1), 103-106 (1991)
  MEDLINE   92009184
REFERENCE   2  (sites)
  AUTHORS   Laurent,B.C., Treitel,M.A. and Carlson,M.
  TITLE     Functional interdependence of the yeast SNF2, SNF5, and SNF6
            proteins in transcriptional activation
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 88 (7), 2687-2691 (1991)
  MEDLINE   91187857
REFERENCE   3  (bases 1 to 297)
  AUTHORS   Thelu,J.
  TITLE     Plasmosium falciparum DNA helicase
  JOURNAL   Unpublished (1994)
FEATURES             Location/Qualifiers
     source          1..297
                     /organism="Plasmodium falciparum"
                     /note="from human red blood cells"
                     /db_xref="taxon:5833"
     gene            1..297
                     /gene="hel2"
     CDS             <1..>297
                     /gene="hel2"
                     /note="ORF"
                     /codon_start=1
                     /product="DNA helicase"
                     /db_xref="PID:g567852"
                     /translation="CLILCPASLINNWNDEISKWIPNRCNVTCVNDNAKEKIVSKLEG
                     FKYDIQSTVLICSYECFRINNEFLDKSSIDMIICDEAHRLKNDKTKTYTSIYNLT"
BASE COUNT      128 a     29 c     43 g     97 t
ORIGIN
        1 tgtttaatat tatgtccagc tagcttaata aacaattgga atgatgaaat aagtaaatgg
       61 attcccaata gatgtaatgt aacatgtgta aatgataatg caaaagagaa aattgtaagt
      121 aaattagaag gatttaaata tgacatacaa tctactgtct tgatatgttc ttatgaatgt
      181 tttcgtataa ataatgaatt tctagataaa tcatcaatag atatgataat atgtgatgaa
      241 gcacatcgtt taaaaaatga taaaacaaaa acatatacaa gtatttataa tctcaca