LOCUS S75835S2 152 bp DNA INV 26-JUL-1995 DEFINITION Endo16=endoderm-specific marker gene {5' regulatory region} [Strongylocentrotus purpuratus=sea urchins, embryo, Genomic, 152 nt, segment 2 of 2]. ACCESSION S75836 NID g913824 KEYWORDS . 2 of 2 SOURCE purple urchin embryo. ORGANISM Strongylocentrotus purpuratus Eukaryotae; mitochondrial eukaryotes; Metazoa; Echinodermata; Echinozoa; Echinoidea; Euechinoidea; Echinacea; Echinoida; Strongylocentrotidae; Strongylocentrotus. REFERENCE 1 (bases 1 to 152) AUTHORS Yuh,C.H., Ransick,A., Martinez,P., Britten,R.J. and Davidson,E.H. TITLE Complexity and organization of DNA-protein interactions in the 5'-regulatory region of an endoderm-specific marker gene in the sea urchin embryo JOURNAL Mech. Dev. 47 (2), 165-186 (1994) MEDLINE 95110745 REMARK GenBank staff at the National Library of Medicine created this entry [NCBI gibbsq 161743] from the original journal article. This sequence comes from Fig. 1C. FEATURES Location/Qualifiers source 1..152 /organism="Strongylocentrotus purpuratus" /db_xref="taxon:7668" mRNA join(S75835:2281..2391,1..152) gene order(S75835:2307..2391,1..152) /partial /note="endoderm-specific marker gene; exclusively expressed in cells of the vegetal plate and archenteron in the embryos" /gene="Endo16" CDS join(S75835:2307..2391,1..152) /partial /gene="Endo16" /note="exon 2 numbering approximate base on numbering Fig. 1C" /codon_start=1 /translation="MMRLNILLFAVLAVARSMPTGKKYNNFTKLQCDIDEAHTNVGTP RVVDDDSNSLMIFQL" BASE COUNT 41 a 40 c 36 g 35 t ORIGIN 1 agttgcaatg tgacatcgac gaggcccata cgaatgttgg aacaccacga gtagtcgacg 61 atgactctaa ctcactcatg atcttccaac tttgagcttt cactcgacga ggtcgacgag 121 ggcttcctac ccgagatcga atatgcagtc ag //