LOCUS SUSHISES1 787 bp DNA INV 18-MAR-1994 DEFINITION sea urchin (s.purpuratus) early histone genes; H1. ACCESSION J01171 J01203 NID g161501 KEYWORDS histone; histone H1. 1 of 4 SOURCE sea urchin (strongylocentrotus purpuratus) mrna and dna. ORGANISM Strongylocentrotus purpuratus Eukaryotae; mitochondrial eukaryotes; Metazoa; Echinodermata; Echinozoa; Echinoidea; Euechinoidea; Echinacea; Echinoida; Strongylocentrotidae; Strongylocentrotus. REFERENCE 1 (bases 1 to 787) AUTHORS Levy,S., Sures,I. and Kedes,L. TITLE The nucleotide and amino acid coding sequence of a gene for H1 histone that interacts with euchromatin. The early embryonic H1 gene of the sea urchin Strongylocentrotus purpuratus JOURNAL J. Biol. Chem. 257, 9438-9443 (1982) MEDLINE 82265580 COMMENT All four entries beginning <surhises> are from a pair of clones sp2 and sp17 which cover the early histone gene repeat. This unit is about 6.5kb long, conTains the H1, H4, H2B, H3 and H2A genes in that order, and is repeated several hundred times. The five coding regions are separated by DNA spacers not represented in polysomal mRNA; there are no reported introns. [1] compares this sequence with the H1 sequence from P.miliaris (see <surhisp8>, <surhisp9>). mRNA termination is 30-40 bases downstream from the last codon, in the region of a short inverted repeat. FEATURES Location/Qualifiers source 1..787 /organism="Strongylocentrotus purpuratus" /db_xref="taxon:7668" mRNA 73..>728 /note="h1 histone mRNA" CDS 111..728 /note="histone h1" /codon_start=1 /db_xref="PID:g161506" /translation="MAEKNSSKKVTTKKPAAHPPAAEMVATAITELKDRNGSSLQAIK KYIATNFDVQMDRQLLFIKRALKSGVEKGKLVQTKGKGASGSFKVNVQAAKAQASEKA KKEKEKAKLLAQREKAKEKGCSEEGETAEGSRPKKVKAAPKKAKKPVKKTTEKKEKKK TPKKAPKKPAAKKSTPKKTPKKAAAKKPKTAKPKKPAXKKAAKSK" BASE COUNT 263 a 202 c 211 g 109 t 2 others ORIGIN sma site. 1 cggacgaccc gggactgtct cctcccacgt acgcaacaat gccttatatt gagcgttgcc 61 gagccgatgg ttattcgttt tgttaacctc ccgacgcacc gtatatcaag atggctgaga 121 agaatagctc taagaaggtg actactaaga agccggccgc ccacccaccg gctgccgaga 181 tggttgctac agcaatcacc gagttgaagg accgcaatgg ctcctcgctg caagcaataa 241 agaagtatat cgctaccaat ttcgatgtgc agatggaccg acagctgcta ttcatcaagc 301 gggccctaaa gtctggcgtg gagaaaggca aactagtgca gacgaagggg aaaggagctt 361 cgggttcttt caaggtgaat gtgcaggcgg ccaaggcaca ggcgtcggag aaggccaaga 421 aggagaagga gaaggcaaaa ctgctagcac agcgtgagaa ggccaaggaa aaaggctgca 481 gcgaagaagg agaaactgca gaaggcagcc gcccaaagaa agtcaaggca gcccccaaga 541 aagcgaagaa gccagtaaag aaaacgacag agaagaaaga gaagaagaag actccaaaga 601 aggcacccaa gaagccagca gccaagaaat caacaccaaa gaagacgccc aagaaggcag 661 ccgcaaagaa acccaagact gccaagccca agaagcctgc ggnnaagaag gctgcaaagt 721 ccaagtgatt tgcacgccaa ctttcccatc ctaccaaaac ggctcttttc agagccacca 781 cataccc //