LOCUS       SUSHISES1     787 bp    DNA             INV       18-MAR-1994
DEFINITION  sea urchin (s.purpuratus) early histone genes; H1.
ACCESSION   J01171 J01203
NID         g161501
KEYWORDS    histone; histone H1.
            1 of 4
SOURCE      sea urchin (strongylocentrotus purpuratus) mrna and dna.
  ORGANISM  Strongylocentrotus purpuratus
            Eukaryotae; mitochondrial eukaryotes; Metazoa; Echinodermata;
            Echinozoa; Echinoidea; Euechinoidea; Echinacea; Echinoida;
            Strongylocentrotidae; Strongylocentrotus.
REFERENCE   1  (bases 1 to 787)
  AUTHORS   Levy,S., Sures,I. and Kedes,L.
  TITLE     The nucleotide and amino acid coding sequence of a gene for H1
            histone that interacts with euchromatin. The early embryonic H1
            gene of the sea urchin Strongylocentrotus purpuratus
  JOURNAL   J. Biol. Chem. 257, 9438-9443 (1982)
  MEDLINE   82265580
COMMENT     All four entries beginning <surhises> are from a pair of clones sp2
            and sp17 which cover the early histone gene repeat. This unit is
            about 6.5kb long, conTains the H1, H4, H2B, H3 and H2A genes in
            that order, and is repeated several hundred times. The five coding
            regions are separated by DNA spacers not represented in polysomal
            mRNA; there are no reported introns. [1] compares this sequence
            with the H1 sequence from P.miliaris (see <surhisp8>, <surhisp9>).
            mRNA termination is 30-40 bases downstream from the last codon, in
            the region of a short inverted repeat.
FEATURES             Location/Qualifiers
     source          1..787
                     /organism="Strongylocentrotus purpuratus"
                     /db_xref="taxon:7668"
     mRNA            73..>728
                     /note="h1 histone mRNA"
     CDS             111..728
                     /note="histone h1"
                     /codon_start=1
                     /db_xref="PID:g161506"
                     /translation="MAEKNSSKKVTTKKPAAHPPAAEMVATAITELKDRNGSSLQAIK
                     KYIATNFDVQMDRQLLFIKRALKSGVEKGKLVQTKGKGASGSFKVNVQAAKAQASEKA
                     KKEKEKAKLLAQREKAKEKGCSEEGETAEGSRPKKVKAAPKKAKKPVKKTTEKKEKKK
                     TPKKAPKKPAAKKSTPKKTPKKAAAKKPKTAKPKKPAXKKAAKSK"
BASE COUNT      263 a    202 c    211 g    109 t      2 others
ORIGIN      sma site.
        1 cggacgaccc gggactgtct cctcccacgt acgcaacaat gccttatatt gagcgttgcc
       61 gagccgatgg ttattcgttt tgttaacctc ccgacgcacc gtatatcaag atggctgaga
      121 agaatagctc taagaaggtg actactaaga agccggccgc ccacccaccg gctgccgaga
      181 tggttgctac agcaatcacc gagttgaagg accgcaatgg ctcctcgctg caagcaataa
      241 agaagtatat cgctaccaat ttcgatgtgc agatggaccg acagctgcta ttcatcaagc
      301 gggccctaaa gtctggcgtg gagaaaggca aactagtgca gacgaagggg aaaggagctt
      361 cgggttcttt caaggtgaat gtgcaggcgg ccaaggcaca ggcgtcggag aaggccaaga
      421 aggagaagga gaaggcaaaa ctgctagcac agcgtgagaa ggccaaggaa aaaggctgca
      481 gcgaagaagg agaaactgca gaaggcagcc gcccaaagaa agtcaaggca gcccccaaga
      541 aagcgaagaa gccagtaaag aaaacgacag agaagaaaga gaagaagaag actccaaaga
      601 aggcacccaa gaagccagca gccaagaaat caacaccaaa gaagacgccc aagaaggcag
      661 ccgcaaagaa acccaagact gccaagccca agaagcctgc ggnnaagaag gctgcaaagt
      721 ccaagtgatt tgcacgccaa ctttcccatc ctaccaaaac ggctcttttc agagccacca
      781 cataccc
//